Example sequence

Below is an amino acid sequence (fragment) of a protein - Ent-kaurene oxidase – derived from peach (Prunus persica), downloaded from UniProt (2007-10-15) and appearing in FASTA format. It is provided as an example amino acid sequence, which can be copied and pasted into the acceptor window of EVALLER 2.0.

Please note: the entire text string must be loaded into the aforementioned window, in order to fulfil EVALLER’s format requirements.

 

 

 

>Q84UV3|Q84UV3_PRUPE Ent-kaurene oxidase (Fragment) - Prunus persica (Peach).
DWRDFLPYLRWVPNKSLEMKIQRLYTRRSAVMNALIDDRKKGIASGEELNCYTDYLLSEA
KTLTSEQIAMLLWETIIETADTTLVTTEWAMYEIAKDSNRQGRLYQEIQNVCGSNKITEE
HLSQLPYLSAVFHETLRKHSPAPIVPLRYAHEDTQLGGYYVPAGSEIAINIYGCSMDKNQ
WESPGEWKPERFLEPKYDPMDLYKTMAFGAGKRVCAGSLQAMLIACTTIGRLVQEFEWKL
RDGEEENVDTVGLTTHKLHPMHAILKPRN

Updated: 03/10/2008

National Food Agency, Box 622, SE-751 26 Uppsala, +46 18 175500  More information

 

No text at the moment - there will be information about the web site later on